SCOP 1.65: Domain d3gcc__: 3gcc -

Lineage for d3gcc__ (3gcc -)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.10: DNA-binding domain [54170] (1 superfamily)
   beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.10.1: DNA-binding domain [54171] (4 families)

5. Family d.10.1.2: GCC-box binding domain [54175] (1 protein)

6. Protein GCC-box binding domain [54176] (1 species)

7. Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [54177] (3 PDB entries)

8. Domain d3gcc__: 3gcc - [37483]

Details for d3gcc__

PDB Entry: 3gcc

PDB Description: solution structure of the gcc-box binding domain, nmr, 46 structures

SCOP Domain Sequences for d3gcc__:

Sequence; same for both SEQRES and ATOM records:

>d3gcc__ d.10.1.2 (-) GCC-box binding domain {Mouse-ear cress (Arabidopsis thaliana)}
khyrgvrqrpwgkfaaeirdpakngarvwlgtfetaedaalaydraafrmrgsrallnfp
lrv

Timeline for d3gcc__:

• d3gcc__ first appeared (with stable ids) in SCOP 1.55
  
• d3gcc__ appears in SCOP 1.63
  
• d3gcc__ appears in SCOP 1.67
  
• d3gcc__ appears in the current release, SCOPe 2.08, called d3gcca_