Lineage for d3gcc__ (3gcc -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30212Fold d.10: DNA-binding domain [54170] (1 superfamily)
  4. 30213Superfamily d.10.1: DNA-binding domain [54171] (3 families) (S)
  5. 30221Family d.10.1.2: GCC-box binding domain [54175] (1 protein)
  6. 30222Protein GCC-box binding domain [54176] (1 species)
  7. 30223Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [54177] (3 PDB entries)
  8. 30225Domain d3gcc__: 3gcc - [37483]

Details for d3gcc__

PDB Entry: 3gcc (more details)

PDB Description: solution structure of the gcc-box binding domain, nmr, 46 structures

SCOP Domain Sequences for d3gcc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gcc__ d.10.1.2 (-) GCC-box binding domain {Mouse-ear cress (Arabidopsis thaliana)}
khyrgvrqrpwgkfaaeirdpakngarvwlgtfetaedaalaydraafrmrgsrallnfp
lrv

SCOP Domain Coordinates for d3gcc__:

Click to download the PDB-style file with coordinates for d3gcc__.
(The format of our PDB-style files is described here.)

Timeline for d3gcc__: