Lineage for d1gcca_ (1gcc A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1891193Fold d.10: DNA-binding domain [54170] (1 superfamily)
    beta(3)-alpha; 2 layers: alpha/beta
  4. 1891194Superfamily d.10.1: DNA-binding domain [54171] (5 families) (S)
  5. 1891202Family d.10.1.2: GCC-box binding domain [54175] (1 protein)
  6. 1891203Protein GCC-box binding domain [54176] (1 species)
  7. 1891204Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [54177] (3 PDB entries)
  8. 1891205Domain d1gcca_: 1gcc A: [37482]
    protein/DNA complex

Details for d1gcca_

PDB Entry: 1gcc (more details)

PDB Description: solution nmr structure of the complex of gcc-box binding domain of aterf1 and gcc-box dna, minimized average structure
PDB Compounds: (A:) ethylene responsive element binding factor 1

SCOPe Domain Sequences for d1gcca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gcca_ d.10.1.2 (A:) GCC-box binding domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
khyrgvrqrpwgkfaaeirdpakngarvwlgtfetaedaalaydraafrmrgsrallnfp
lrv

SCOPe Domain Coordinates for d1gcca_:

Click to download the PDB-style file with coordinates for d1gcca_.
(The format of our PDB-style files is described here.)

Timeline for d1gcca_: