Lineage for d1tn9a_ (1tn9 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1016572Fold d.10: DNA-binding domain [54170] (1 superfamily)
    beta(3)-alpha; 2 layers: alpha/beta
  4. 1016573Superfamily d.10.1: DNA-binding domain [54171] (4 families) (S)
  5. 1016574Family d.10.1.1: DNA-binding domain from tn916 integrase [54172] (1 protein)
  6. 1016575Protein DNA-binding domain from tn916 integrase [54173] (1 species)
  7. 1016576Species Enterococcus faecalis [TaxId:1351] [54174] (4 PDB entries)
  8. 1016580Domain d1tn9a_: 1tn9 A: [37481]
    protein/DNA complex

Details for d1tn9a_

PDB Entry: 1tn9 (more details)

PDB Description: the solution structure of tn916 integrase n-terminal domain/dna complex
PDB Compounds: (A:) protein (integrase)

SCOPe Domain Sequences for d1tn9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tn9a_ d.10.1.1 (A:) DNA-binding domain from tn916 integrase {Enterococcus faecalis [TaxId: 1351]}
ekrrdnrgrilktgesqrkdgrylykyidsfgepqfvyswklvatdrvpagkrdaislre
kiaelqkdi

SCOPe Domain Coordinates for d1tn9a_:

Click to download the PDB-style file with coordinates for d1tn9a_.
(The format of our PDB-style files is described here.)

Timeline for d1tn9a_: