Lineage for d2bb8__ (2bb8 -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77601Fold d.10: DNA-binding domain [54170] (1 superfamily)
  4. 77602Superfamily d.10.1: DNA-binding domain [54171] (3 families) (S)
  5. 77603Family d.10.1.1: DNA-binding domain from tn916 integrase [54172] (1 protein)
  6. 77604Protein DNA-binding domain from tn916 integrase [54173] (1 species)
  7. 77605Species Enterococcus faecalis [TaxId:1351] [54174] (4 PDB entries)
  8. 77608Domain d2bb8__: 2bb8 - [37480]

Details for d2bb8__

PDB Entry: 2bb8 (more details)

PDB Description: n-terminal dna binding domain from tn916 integrase, nmr, minimized average structure

SCOP Domain Sequences for d2bb8__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bb8__ d.10.1.1 (-) DNA-binding domain from tn916 integrase {Enterococcus faecalis}
ekrrdnrgrilktgesqrkdgrylykyidsfgepqfvyswklvatdrvpagkrdcislre
kiaelqkdihd

SCOP Domain Coordinates for d2bb8__:

Click to download the PDB-style file with coordinates for d2bb8__.
(The format of our PDB-style files is described here.)

Timeline for d2bb8__: