Lineage for d6rkcf2 (6rkc F:106-224)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976292Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2976293Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2976427Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 2976428Protein automated matches [254617] (15 species)
    not a true protein
  7. 2976742Species Ureaplasma urealyticum [TaxId:519849] [374759] (5 PDB entries)
  8. 2976789Domain d6rkcf2: 6rkc F:106-224 [374793]
    Other proteins in same PDB: d6rkcb4, d6rkcf4
    automated match to d5h9ua2
    complexed with k, mg, ppk, sam

Details for d6rkcf2

PDB Entry: 6rkc (more details), 2.56 Å

PDB Description: inter-dimeric interface controls function and stability of s- methionine adenosyltransferase from u. urealiticum
PDB Compounds: (F:) Methionine adenosyltransferase

SCOPe Domain Sequences for d6rkcf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rkcf2 d.130.1.0 (F:106-224) automated matches {Ureaplasma urealyticum [TaxId: 519849]}
knligagdqgivfgyacdetpqympltsvlahellkeierqrrskefikiqadmksqvsi
dysnstplietmlvsiqhdedydveyfnkkvsaimeqiakkynlntnfkkiinssgrfv

SCOPe Domain Coordinates for d6rkcf2:

Click to download the PDB-style file with coordinates for d6rkcf2.
(The format of our PDB-style files is described here.)

Timeline for d6rkcf2: