SCOPe 2.08: Domain d6rkcf2: 6rkc F:106-224

Lineage for d6rkcf2 (6rkc F:106-224)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
   duplication: consists of 3 similar intertwined domains
   structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta

4. Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families)

5. Family d.130.1.0: automated matches [254267] (1 protein)
   not a true family

6. Protein automated matches [254617] (15 species)
   not a true protein

7. Species Ureaplasma urealyticum [TaxId:519849] [374759] (5 PDB entries)

8. Domain d6rkcf2: 6rkc F:106-224 [374793]
   Other proteins in same PDB: d6rkcb4, d6rkcf4
   automated match to d5h9ua2
   complexed with k, mg, ppk, sam

Details for d6rkcf2

PDB Entry: 6rkc, 2.56 Å

PDB Description: inter-dimeric interface controls function and stability of s- methionine adenosyltransferase from u. urealiticum

PDB Compounds: (F:) Methionine adenosyltransferase

SCOPe Domain Sequences for d6rkcf2:

Sequence; same for both SEQRES and ATOM records:

>d6rkcf2 d.130.1.0 (F:106-224) automated matches {Ureaplasma urealyticum [TaxId: 519849]}
knligagdqgivfgyacdetpqympltsvlahellkeierqrrskefikiqadmksqvsi
dysnstplietmlvsiqhdedydveyfnkkvsaimeqiakkynlntnfkkiinssgrfv

Timeline for d6rkcf2:

• d6rkcf2 first appeared in SCOPe 2.07