Lineage for d1bb8a_ (1bb8 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1193615Fold d.10: DNA-binding domain [54170] (1 superfamily)
    beta(3)-alpha; 2 layers: alpha/beta
  4. 1193616Superfamily d.10.1: DNA-binding domain [54171] (4 families) (S)
  5. 1193617Family d.10.1.1: DNA-binding domain from tn916 integrase [54172] (1 protein)
  6. 1193618Protein DNA-binding domain from tn916 integrase [54173] (1 species)
  7. 1193619Species Enterococcus faecalis [TaxId:1351] [54174] (4 PDB entries)
  8. 1193620Domain d1bb8a_: 1bb8 A: [37478]

Details for d1bb8a_

PDB Entry: 1bb8 (more details)

PDB Description: n-terminal dna binding domain from tn916 integrase, nmr, 25 structures
PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d1bb8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bb8a_ d.10.1.1 (A:) DNA-binding domain from tn916 integrase {Enterococcus faecalis [TaxId: 1351]}
ekrrdnrgrilktgesqrkdgrylykyidsfgepqfvyswklvatdrvpagkrdcislre
kiaelqkdihd

SCOPe Domain Coordinates for d1bb8a_:

Click to download the PDB-style file with coordinates for d1bb8a_.
(The format of our PDB-style files is described here.)

Timeline for d1bb8a_: