Lineage for d1e0bb_ (1e0b B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1785119Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 1785158Family b.34.13.2: Chromo domain [54165] (8 proteins)
    lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold
  6. 1785203Protein Heterochromatin protein 1, HP1 [54166] (4 species)
    duplication: consists of two homologous domains, N-terminal chromo domain and C-terminal chromo shadow domain
  7. 1785204Species Fission yeast (Schizosaccharomyces pombe), SWI6 [TaxId:4896] [54169] (1 PDB entry)
  8. 1785206Domain d1e0bb_: 1e0b B: [37477]
    C-terminal shadow chromo domain
    complexed with 1pg

Details for d1e0bb_

PDB Entry: 1e0b (more details), 1.9 Å

PDB Description: chromo shadow domain from fission yeast swi6 protein.
PDB Compounds: (B:) swi6 protein

SCOPe Domain Sequences for d1e0bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0bb_ b.34.13.2 (B:) Heterochromatin protein 1, HP1 {Fission yeast (Schizosaccharomyces pombe), SWI6 [TaxId: 4896]}
ydswedlvssidtierkddgtleiyltwkngaishhpstitnkkcpqkmlqfyeshltf

SCOPe Domain Coordinates for d1e0bb_:

Click to download the PDB-style file with coordinates for d1e0bb_.
(The format of our PDB-style files is described here.)

Timeline for d1e0bb_: