Lineage for d1ap0__ (1ap0 -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.9: IL8-like [54116] (2 superfamilies) - Superfamily d.9.2: Chromo domain-like [54160] (2 families)
Family d.9.2.2: Chromo domain [54165] (2 proteins) 
Protein Modifier protein 1 (M31, HP1 beta) [54166] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [54167] (2 PDB entries) 
Domain d1ap0__: 1ap0 - [37475]
Details for d1ap0__
PDB Entry: 1ap0 (more details)
PDB Description: structure of the chromatin binding (chromo) domain from mouse modifier protein 1, nmr, 26 structures
SCOP Domain Sequences for d1ap0__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ap0__ d.9.2.2 (-) Modifier protein 1 (M31, HP1 beta) {Mouse (Mus musculus)}
hmveevleeeeeeyvvekvldrrvvkgkveyllkwkgfsdedntwepeenldcpdliaef
lqsqktahetdks
SCOP Domain Coordinates for d1ap0__:
Click to download the PDB-style file with coordinates for d1ap0__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ap0__:
- d1ap0__ appears in SCOP 1.57
- d1ap0__ appears in the current release, SCOPe 2.08, called d1ap0a_
View in 3D