Lineage for d1dz1b_ (1dz1 B:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77416Fold d.9: IL8-like [54116] (2 superfamilies)
  4. 77570Superfamily d.9.2: Chromo domain-like [54160] (2 families) (S)
  5. 77588Family d.9.2.2: Chromo domain [54165] (3 proteins)
  6. 77596Protein Modifier protein 1 (M31, HP1 beta) [54166] (1 species)
  7. 77597Species Mouse (Mus musculus) [TaxId:10090] [54167] (2 PDB entries)
  8. 77599Domain d1dz1b_: 1dz1 B: [37474]

Details for d1dz1b_

PDB Entry: 1dz1 (more details)

PDB Description: mouse hp1 (m31) c terminal (shadow chromo) domain

SCOP Domain Sequences for d1dz1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dz1b_ d.9.2.2 (B:) Modifier protein 1 (M31, HP1 beta) {Mouse (Mus musculus)}
hmkeesekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvi
sfyeerltwh

SCOP Domain Coordinates for d1dz1b_:

Click to download the PDB-style file with coordinates for d1dz1b_.
(The format of our PDB-style files is described here.)

Timeline for d1dz1b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dz1a_