Lineage for d1dz1b_ (1dz1 B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.9: IL8-like [54116] (2 superfamilies) - Superfamily d.9.2: Chromo domain-like [54160] (2 families)
Family d.9.2.2: Chromo domain [54165] (2 proteins) 
Protein Modifier protein 1 (M31, HP1 beta) [54166] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [54167] (2 PDB entries) 
Domain d1dz1b_: 1dz1 B: [37474]
Details for d1dz1b_
PDB Entry: 1dz1 (more details)
PDB Description: mouse hp1 (m31) c terminal (shadow chromo) domain
SCOP Domain Sequences for d1dz1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dz1b_ d.9.2.2 (B:) Modifier protein 1 (M31, HP1 beta) {Mouse (Mus musculus)}
hmkeesekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvi
sfyeerltwh
SCOP Domain Coordinates for d1dz1b_:
Click to download the PDB-style file with coordinates for d1dz1b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dz1b_:
- d1dz1b_ appears in SCOP 1.57
- d1dz1b_ appears in the current release, SCOPe 2.08, called d1dz1b1
View in 3D
