SCOPe 2.07: Domain d6kdyb1: 6kdy B:14-340

Lineage for d6kdyb1 (6kdy B:14-340)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.0: automated matches [191423] (1 protein)
   not a true family

6. Protein automated matches [190603] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [329721] (11 PDB entries)

8. Domain d6kdyb1: 6kdy B:14-340 [374734]
   Other proteins in same PDB: d6kdyb2, d6kdyd2, d6kdyf2, d6kdyh2
   automated match to d5grhb_
   complexed with 2pe, nad, p6g, pe7, pg4

Details for d6kdyb1

PDB Entry: 6kdy, 3.02 Å

PDB Description: crystal structure of the alpha bata heterodimer of human idh3 in complex with nad.

PDB Compounds: (B:) Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial

SCOPe Domain Sequences for d6kdyb1:

Sequence; same for both SEQRES and ATOM records:

>d6kdyb1 c.77.1.0 (B:14-340) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sfpvtmlpgdgvgpelmhavkevfkaaavpvefqehhlsevqnmaseekleqvlssmken
kvaiigkihtpmeykgelasydmrlrrkldlfanvvhvkslpgymtrhnnldlviireqt
egeysslehesargvieclkivtraksqriakfafdyatkkgrgkvtavhkanimklgdg
lflqcceevaelypkikfetmiidnccmqlvqnpyqfdvlvmpnlygniidnlaaglvgg
agvvpgesysaeyavfetgarhpfaqavgrnianptamllsasnmlrhlnleyhssmiad
avkkvikvgkvrtsdmggyatchdfte

Timeline for d6kdyb1:

• d6kdyb1 is new in SCOPe 2.07-stable
  
• d6kdyb1 appears in the current release, SCOPe 2.08