Lineage for d1sap__ (1sap -)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.9: IL8-like [54116] (2 superfamilies) 
Superfamily d.9.2: Chromo domain-like [54160] (2 families) 
Family d.9.2.1: "Histone-like" proteins from archaea [54161] (1 protein) Protein DNA-binding protein [54162] (2 species) 
Species Archaeon Sulfolobus acidocaldarius, Sac7d [TaxId:2285] [54164] (6 PDB entries) 
Domain d1sap__: 1sap - [37472]
Details for d1sap__
PDB Entry: 1sap (more details)
PDB Description: hyperthermophile protein, relaxation matrix refinement structure
SCOP Domain Sequences for d1sap__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sap__ d.9.2.1 (-) DNA-binding protein {Archaeon Sulfolobus acidocaldarius, Sac7d}
mvkvkfkykgeekevdtskikkvwrvgkmvsftyddngktgrgavsekdapkelldmlar
aerekk
SCOP Domain Coordinates for d1sap__:
Click to download the PDB-style file with coordinates for d1sap__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1sap__:
- d1sap__ first appeared (with stable ids) in SCOP 1.55
- d1sap__ appears in SCOP 1.59
- d1sap__ appears in the current release, SCOPe 2.08, called d1sapa_
View in 3D