Domain d1ca5a_: 1ca5 A:

Structural Classification of Proteins and ASTRAL release 1.75 (June 2009)

Lineage for d1ca5a_ (1ca5 A:)

Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds)
Fold b.34: SH3-like barrel [50036] (21 superfamilies)
barrel, partly opened; n*=4, S*=8; meander
the last strand is interrupted by a turn of 3-10 helix
Superfamily b.34.13: Chromo domain-like [54160] (3 families)
SH3-like barrel is capped by a C-terminal helix
Family b.34.13.1: "Histone-like" proteins from archaea [54161] (1 protein)
Protein DNA-binding protein [54162] (2 species)
Species Archaeon Sulfolobus acidocaldarius, Sac7d [TaxId:2285] [54164] (9 PDB entries)
Uniprot P13123
Domain d1ca5a_: 1ca5 A: [37471]

Details for d1ca5a_

PDB Entry: 1ca5 (more details)
PDB Description: intercalation site of hyperthermophile chromosomal protein s bound to dna
PDB Compounds: (A:) chromosomal protein sac7d

SCOP Domain Sequences for d1ca5a_:
Sequence; same for both SEQRES and ATOM records: (download)

>d1ca5a_ b.34.13.1 (A:) DNA-binding protein {Archaeon Sulfolobus acidocaldarius, Sac7d [TaxId: 2285]} vkvkfkykgeekevdtskikkvwrvgkmvsftyddngktgrgavsekdapkelldmlara erekk

SCOP Domain Coordinates for d1ca5a_:

Click to download the PDB-style file with coordinates for d1ca5a_.
(The format of our PDB-style files is described here.)

Timeline for d1ca5a_:
d1ca5a_ appears in SCOP 1.73
d1ca5a_ appears in SCOP 1.75A

d1ca5a_
(click for larger image)

d1ca5a_ in context of PDB