SCOP 1.75: Domain d1ca5a_: 1ca5 A:

Lineage for d1ca5a_ (1ca5 A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (3 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.1: "Histone-like" proteins from archaea [54161] (1 protein)

6. Protein DNA-binding protein [54162] (2 species)

7. Species Archaeon Sulfolobus acidocaldarius, Sac7d [TaxId:2285] [54164] (9 PDB entries)
   Uniprot P13123

8. Domain d1ca5a_: 1ca5 A: [37471]

Details for d1ca5a_

PDB Entry: 1ca5, 2.2 Å

PDB Description: intercalation site of hyperthermophile chromosomal protein sso7d/sac7d bound to dna

PDB Compounds: (A:) chromosomal protein sac7d

SCOP Domain Sequences for d1ca5a_:

Sequence; same for both SEQRES and ATOM records:

>d1ca5a_ b.34.13.1 (A:) DNA-binding protein {Archaeon Sulfolobus acidocaldarius, Sac7d [TaxId: 2285]}
vkvkfkykgeekevdtskikkvwrvgkmvsftyddngktgrgavsekdapkelldmlara
erekk

Timeline for d1ca5a_:

• d1ca5a_ first appeared (with stable ids) in SCOP 1.55
  
• d1ca5a_ appears in SCOP 1.73
  
• d1ca5a_ appears in SCOPe 2.01
  
• d1ca5a_ appears in the current release, SCOPe 2.08