Class b: All beta proteins [48724] (149 folds) |
Fold b.34: SH3-like barrel [50036] (15 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.13: Chromo domain-like [54160] (3 families) SH3-like barrel is capped by a C-terminal helix |
Family b.34.13.1: "Histone-like" proteins from archaea [54161] (1 protein) |
Protein DNA-binding protein [54162] (2 species) |
Species Archaeon Sulfolobus acidocaldarius, Sac7d [TaxId:2285] [54164] (8 PDB entries) |
Domain d1ca5a_: 1ca5 A: [37471] |
PDB Entry: 1ca5 (more details), 2.2 Å
SCOP Domain Sequences for d1ca5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ca5a_ b.34.13.1 (A:) DNA-binding protein {Archaeon Sulfolobus acidocaldarius, Sac7d} vkvkfkykgeekevdtskikkvwrvgkmvsftyddngktgrgavsekdapkelldmlara erekk
Timeline for d1ca5a_: