Lineage for d1ca5a_ (1ca5 A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 557280Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 557987Superfamily b.34.13: Chromo domain-like [54160] (3 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 557988Family b.34.13.1: "Histone-like" proteins from archaea [54161] (1 protein)
  6. 557989Protein DNA-binding protein [54162] (2 species)
  7. 557990Species Archaeon Sulfolobus acidocaldarius, Sac7d [TaxId:2285] [54164] (8 PDB entries)
  8. 557996Domain d1ca5a_: 1ca5 A: [37471]

Details for d1ca5a_

PDB Entry: 1ca5 (more details), 2.2 Å

PDB Description: intercalation site of hyperthermophile chromosomal protein sso7d/sac7d bound to dna

SCOP Domain Sequences for d1ca5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ca5a_ b.34.13.1 (A:) DNA-binding protein {Archaeon Sulfolobus acidocaldarius, Sac7d}
vkvkfkykgeekevdtskikkvwrvgkmvsftyddngktgrgavsekdapkelldmlara
erekk

SCOP Domain Coordinates for d1ca5a_:

Click to download the PDB-style file with coordinates for d1ca5a_.
(The format of our PDB-style files is described here.)

Timeline for d1ca5a_: