Lineage for d1ca6a_ (1ca6 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394630Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2394631Family b.34.13.1: "Histone-like" proteins from archaea [54161] (2 proteins)
  6. 2394632Protein DNA-binding protein [54162] (2 species)
  7. 2394633Species Sulfolobus acidocaldarius, Sac7d [TaxId:2285] [54164] (8 PDB entries)
    Uniprot P13123
  8. 2394639Domain d1ca6a_: 1ca6 A: [37470]
    protein/DNA complex

Details for d1ca6a_

PDB Entry: 1ca6 (more details), 2.2 Å

PDB Description: intercalation site of hyperthermophile chromosomal protein sso7d/sac7d bound to dna
PDB Compounds: (A:) chromosomal protein sac7d

SCOPe Domain Sequences for d1ca6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ca6a_ b.34.13.1 (A:) DNA-binding protein {Sulfolobus acidocaldarius, Sac7d [TaxId: 2285]}
mvkvkfkykgeekevdtskikkvwrvgkmvsftyddngktgrgavsekdapkelldmlar
aerekk

SCOPe Domain Coordinates for d1ca6a_:

Click to download the PDB-style file with coordinates for d1ca6a_.
(The format of our PDB-style files is described here.)

Timeline for d1ca6a_: