| Class b: All beta proteins [48724] (165 folds) |
| Fold b.34: SH3-like barrel [50036] (18 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.13: Chromo domain-like [54160] (3 families) ![]() SH3-like barrel is capped by a C-terminal helix |
| Family b.34.13.1: "Histone-like" proteins from archaea [54161] (1 protein) |
| Protein DNA-binding protein [54162] (2 species) |
| Species Archaeon Sulfolobus acidocaldarius, Sac7d [TaxId:2285] [54164] (9 PDB entries) |
| Domain d1ca6a_: 1ca6 A: [37470] |
PDB Entry: 1ca6 (more details), 2.2 Å
SCOP Domain Sequences for d1ca6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ca6a_ b.34.13.1 (A:) DNA-binding protein {Archaeon Sulfolobus acidocaldarius, Sac7d [TaxId: 2285]}
mvkvkfkykgeekevdtskikkvwrvgkmvsftyddngktgrgavsekdapkelldmlar
aerekk
Timeline for d1ca6a_: