Lineage for d1bnza_ (1bnz A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 797173Superfamily b.34.13: Chromo domain-like [54160] (3 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 797174Family b.34.13.1: "Histone-like" proteins from archaea [54161] (1 protein)
  6. 797175Protein DNA-binding protein [54162] (2 species)
  7. 797176Species Archaeon Sulfolobus acidocaldarius, Sac7d [TaxId:2285] [54164] (9 PDB entries)
    Uniprot P13123
  8. 797178Domain d1bnza_: 1bnz A: [37468]

Details for d1bnza_

PDB Entry: 1bnz (more details), 2 Å

PDB Description: sso7d hyperthermophile protein/dna complex
PDB Compounds: (A:) DNA-binding protein 7a

SCOP Domain Sequences for d1bnza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bnza_ b.34.13.1 (A:) DNA-binding protein {Archaeon Sulfolobus acidocaldarius, Sac7d [TaxId: 2285]}
matvkfkykgeekevdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmle
kqkk

SCOP Domain Coordinates for d1bnza_:

Click to download the PDB-style file with coordinates for d1bnza_.
(The format of our PDB-style files is described here.)

Timeline for d1bnza_: