![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.13: Chromo domain-like [54160] (3 families) ![]() SH3-like barrel is capped by a C-terminal helix |
![]() | Family b.34.13.1: "Histone-like" proteins from archaea [54161] (1 protein) |
![]() | Protein DNA-binding protein [54162] (2 species) |
![]() | Species Archaeon Sulfolobus acidocaldarius, Sac7d [TaxId:2285] [54164] (9 PDB entries) Uniprot P13123 |
![]() | Domain d1bnza_: 1bnz A: [37468] |
PDB Entry: 1bnz (more details), 2 Å
SCOP Domain Sequences for d1bnza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bnza_ b.34.13.1 (A:) DNA-binding protein {Archaeon Sulfolobus acidocaldarius, Sac7d [TaxId: 2285]} matvkfkykgeekevdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmle kqkk
Timeline for d1bnza_: