Lineage for d1bnza_ (1bnz A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30036Fold d.9: IL8-like [54116] (2 superfamilies)
  4. Superfamily d.9.2: Chromo domain-like [54160] (2 families) (S)
  5. Family d.9.2.1: "Histone-like" proteins from arhaea [54161] (1 protein)
  6. Protein DNA-binding protein [54162] (2 species)
  7. 30188Species Sulfolobus acidocaldarius, Sac7d [TaxId:2285] [54164] (6 PDB entries)
  8. 30191Domain d1bnza_: 1bnz A: [37468]

Details for d1bnza_

PDB Entry: 1bnz (more details), 2 Å

PDB Description: sso7d hyperthermophile protein/dna complex

SCOP Domain Sequences for d1bnza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bnza_ d.9.2.1 (A:) DNA-binding protein {Sulfolobus acidocaldarius, Sac7d}
matvkfkykgeekevdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmle
kqkk

SCOP Domain Coordinates for d1bnza_:

Click to download the PDB-style file with coordinates for d1bnza_.
(The format of our PDB-style files is described here.)

Timeline for d1bnza_: