Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.13: Chromo domain-like [54160] (4 families) SH3-like barrel is capped by a C-terminal helix |
Family b.34.13.1: Histone-like proteins from archaea [54161] (2 proteins) |
Protein DNA-binding protein [54162] (2 species) |
Species Sulfolobus acidocaldarius, Sac7d [TaxId:2285] [54164] (8 PDB entries) Uniprot P13123 |
Domain d1bnza_: 1bnz A: [37468] protein/DNA complex |
PDB Entry: 1bnz (more details), 2 Å
SCOPe Domain Sequences for d1bnza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bnza_ b.34.13.1 (A:) DNA-binding protein {Sulfolobus acidocaldarius, Sac7d [TaxId: 2285]} matvkfkykgeekevdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmle kqkk
Timeline for d1bnza_: