Lineage for d1azpa_ (1azp A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 557280Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 557987Superfamily b.34.13: Chromo domain-like [54160] (3 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 557988Family b.34.13.1: "Histone-like" proteins from archaea [54161] (1 protein)
  6. 557989Protein DNA-binding protein [54162] (2 species)
  7. 557990Species Archaeon Sulfolobus acidocaldarius, Sac7d [TaxId:2285] [54164] (8 PDB entries)
  8. 557991Domain d1azpa_: 1azp A: [37467]
    protein/DNA complex

Details for d1azpa_

PDB Entry: 1azp (more details), 1.6 Å

PDB Description: hyperthermophile chromosomal protein sac7d bound with kinked dna duplex

SCOP Domain Sequences for d1azpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1azpa_ b.34.13.1 (A:) DNA-binding protein {Archaeon Sulfolobus acidocaldarius, Sac7d}
mvkvkfkykgeekevdtskikkvwrvgkmvsftyddngktgrgavsekdapkelldmlar
aerekk

SCOP Domain Coordinates for d1azpa_:

Click to download the PDB-style file with coordinates for d1azpa_.
(The format of our PDB-style files is described here.)

Timeline for d1azpa_: