Lineage for d1azpa_ (1azp A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30036Fold d.9: IL8-like [54116] (2 superfamilies)
  4. Superfamily d.9.2: Chromo domain-like [54160] (2 families) (S)
  5. Family d.9.2.1: "Histone-like" proteins from arhaea [54161] (1 protein)
  6. Protein DNA-binding protein [54162] (2 species)
  7. 30188Species Sulfolobus acidocaldarius, Sac7d [TaxId:2285] [54164] (6 PDB entries)
  8. 30189Domain d1azpa_: 1azp A: [37467]

Details for d1azpa_

PDB Entry: 1azp (more details), 1.6 Å

PDB Description: hyperthermophile chromosomal protein sac7d bound with kinked dna duplex

SCOP Domain Sequences for d1azpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1azpa_ d.9.2.1 (A:) DNA-binding protein {Sulfolobus acidocaldarius, Sac7d}
mvkvkfkykgeekevdtskikkvwrvgkmvsftyddngktgrgavsekdapkelldmlar
aerekk

SCOP Domain Coordinates for d1azpa_:

Click to download the PDB-style file with coordinates for d1azpa_.
(The format of our PDB-style files is described here.)

Timeline for d1azpa_: