Lineage for d1azpa_ (1azp A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2785033Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2785034Family b.34.13.1: Histone-like proteins from archaea [54161] (2 proteins)
  6. 2785035Protein DNA-binding protein [54162] (2 species)
  7. 2785036Species Sulfolobus acidocaldarius, Sac7d [TaxId:2285] [54164] (8 PDB entries)
    Uniprot P13123
  8. 2785037Domain d1azpa_: 1azp A: [37467]
    protein/DNA complex

Details for d1azpa_

PDB Entry: 1azp (more details), 1.6 Å

PDB Description: hyperthermophile chromosomal protein sac7d bound with kinked dna duplex
PDB Compounds: (A:) protein (hyperthermophile chromosomal protein sac7d)

SCOPe Domain Sequences for d1azpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1azpa_ b.34.13.1 (A:) DNA-binding protein {Sulfolobus acidocaldarius, Sac7d [TaxId: 2285]}
mvkvkfkykgeekevdtskikkvwrvgkmvsftyddngktgrgavsekdapkelldmlar
aerekk

SCOPe Domain Coordinates for d1azpa_:

Click to download the PDB-style file with coordinates for d1azpa_.
(The format of our PDB-style files is described here.)

Timeline for d1azpa_: