Lineage for d1bbxd_ (1bbx D:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77416Fold d.9: IL8-like [54116] (2 superfamilies)
  4. 77570Superfamily d.9.2: Chromo domain-like [54160] (2 families) (S)
  5. 77571Family d.9.2.1: "Histone-like" proteins from archaea [54161] (1 protein)
  6. 77572Protein DNA-binding protein [54162] (2 species)
  7. 77580Species Archaeon Sulfolobus solfataricus, Sso7d [TaxId:2287] [54163] (6 PDB entries)
  8. 77587Domain d1bbxd_: 1bbx D: [37466]

Details for d1bbxd_

PDB Entry: 1bbx (more details)

PDB Description: non-specific protein-dna interactions in the sso7d-dna complex, nmr, 1 structure

SCOP Domain Sequences for d1bbxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bbxd_ d.9.2.1 (D:) DNA-binding protein {Archaeon Sulfolobus solfataricus, Sso7d}
atvkfkykgeekqvdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmlek
qkk

SCOP Domain Coordinates for d1bbxd_:

Click to download the PDB-style file with coordinates for d1bbxd_.
(The format of our PDB-style files is described here.)

Timeline for d1bbxd_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bbxc_