SCOP 1.73: Domain d1bbxc_: 1bbx C:

Lineage for d1bbxc_ (1bbx C:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.34: SH3-like barrel [50036] (18 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (3 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.1: "Histone-like" proteins from archaea [54161] (1 protein)

6. Protein DNA-binding protein [54162] (2 species)

7. Species Archaeon Sulfolobus solfataricus, Sso7d [TaxId:2287] [54163] (8 PDB entries)

8. Domain d1bbxc_: 1bbx C: [37465]

Details for d1bbxc_

PDB Entry: 1bbx

PDB Description: non-specific protein-dna interactions in the sso7d-dna complex, nmr, 1 structure

PDB Compounds: (C:) DNA-binding protein 7d

SCOP Domain Sequences for d1bbxc_:

Sequence; same for both SEQRES and ATOM records:

>d1bbxc_ b.34.13.1 (C:) DNA-binding protein {Archaeon Sulfolobus solfataricus, Sso7d [TaxId: 2287]}
atvkfkykgeekqvdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmlek
qkk

Timeline for d1bbxc_:

• d1bbxc_ first appeared (with stable ids) in SCOP 1.55
  
• d1bbxc_ appears in SCOP 1.71
  
• d1bbxc_ appears in SCOP 1.75
  
• d1bbxc_ appears in the current release, SCOPe 2.08