Lineage for d1bbxc_ (1bbx C:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.9: IL8-like [54116] (2 superfamilies) 
Superfamily d.9.2: Chromo domain-like [54160] (2 families) 
Family d.9.2.1: "Histone-like" proteins from archaea [54161] (1 protein) Protein DNA-binding protein [54162] (2 species) Species Archaeon Sulfolobus solfataricus, Sso7d [TaxId:2287] [54163] (6 PDB entries) 
Domain d1bbxc_: 1bbx C: [37465]
Details for d1bbxc_
PDB Entry: 1bbx (more details)
PDB Description: non-specific protein-dna interactions in the sso7d-dna complex, nmr, 1 structure
SCOP Domain Sequences for d1bbxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bbxc_ d.9.2.1 (C:) DNA-binding protein {Archaeon Sulfolobus solfataricus, Sso7d}
atvkfkykgeekqvdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmlek
qkk
SCOP Domain Coordinates for d1bbxc_:
Click to download the PDB-style file with coordinates for d1bbxc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bbxc_:
View in 3D
