Lineage for d6kdyc_ (6kdy C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2513202Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2513203Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2513666Family c.77.1.0: automated matches [191423] (1 protein)
    not a true family
  6. 2513667Protein automated matches [190603] (24 species)
    not a true protein
  7. 2513717Species Human (Homo sapiens) [TaxId:9606] [329721] (11 PDB entries)
  8. 2513740Domain d6kdyc_: 6kdy C: [374644]
    Other proteins in same PDB: d6kdyb2, d6kdyd2, d6kdyf2, d6kdyh2
    automated match to d3blxc_
    complexed with 2pe, nad, p6g, pe7, pg4

Details for d6kdyc_

PDB Entry: 6kdy (more details), 3.02 Å

PDB Description: crystal structure of the alpha bata heterodimer of human idh3 in complex with nad.
PDB Compounds: (C:) Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial

SCOPe Domain Sequences for d6kdyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kdyc_ c.77.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvqtvtlipgdgigpeisaavmkifdaakapiqweernvtaiqgpggkwmipseakesmd
knkmglkgplktpiaaghpsmnlllrktfdlyanvrpcvsiegyktpytdvnivtirent
egeysgiehvivdgvvqsiklitegaskriaefafeyarnnhrsnvtavhkanimrmsdg
lflqkcrevaesckdikfnemyldtvclnmvqdpsqfdvlvmpnlygdilsdlcagligg
lgvtpsgnigangvaifesvhgtapdiagkdmanptalllsavmmlrhmglfdhaariea
acfatikdgksltkdlggnakcsdfteeicrrvkd

SCOPe Domain Coordinates for d6kdyc_:

Click to download the PDB-style file with coordinates for d6kdyc_.
(The format of our PDB-style files is described here.)

Timeline for d6kdyc_: