SCOP 1.75: Domain d1b4oa_: 1b4o A:

Lineage for d1b4oa_ (1b4o A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (3 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.1: "Histone-like" proteins from archaea [54161] (1 protein)

6. Protein DNA-binding protein [54162] (2 species)

7. Species Archaeon Sulfolobus solfataricus, Sso7d [TaxId:2287] [54163] (8 PDB entries)
   Uniprot P61991

8. Domain d1b4oa_: 1b4o A: [37464]

Details for d1b4oa_

PDB Entry: 1b4o

PDB Description: nmr study of sso7d mutant (f31a) minimized average structure

PDB Compounds: (A:) endoribonuclease p2

SCOP Domain Sequences for d1b4oa_:

Sequence; same for both SEQRES and ATOM records:

>d1b4oa_ b.34.13.1 (A:) DNA-binding protein {Archaeon Sulfolobus solfataricus, Sso7d [TaxId: 2287]}
atvkfkykgeekqvdiskikkvwrvgkmisatydegggktgrgavsekdapkellqmlek
qk

Timeline for d1b4oa_:

• d1b4oa_ first appeared (with stable ids) in SCOP 1.55, called d1b4o__
  
• d1b4oa_ appears in SCOP 1.73
  
• d1b4oa_ appears in SCOPe 2.01
  
• d1b4oa_ appears in the current release, SCOPe 2.08