Lineage for d1b4o__ (1b4o -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77416Fold d.9: IL8-like [54116] (2 superfamilies)
  4. 77570Superfamily d.9.2: Chromo domain-like [54160] (2 families) (S)
  5. 77571Family d.9.2.1: "Histone-like" proteins from archaea [54161] (1 protein)
  6. 77572Protein DNA-binding protein [54162] (2 species)
  7. 77580Species Archaeon Sulfolobus solfataricus, Sso7d [TaxId:2287] [54163] (6 PDB entries)
  8. 77585Domain d1b4o__: 1b4o - [37464]

Details for d1b4o__

PDB Entry: 1b4o (more details)

PDB Description: nmr study of sso7d mutant (f31a) minimized average structure

SCOP Domain Sequences for d1b4o__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b4o__ d.9.2.1 (-) DNA-binding protein {Archaeon Sulfolobus solfataricus, Sso7d}
atvkfkykgeekqvdiskikkvwrvgkmisatydegggktgrgavsekdapkellqmlek
qk

SCOP Domain Coordinates for d1b4o__:

Click to download the PDB-style file with coordinates for d1b4o__.
(The format of our PDB-style files is described here.)

Timeline for d1b4o__: