SCOPe 2.05: Domain d1ssoa_: 1sso A:

Lineage for d1ssoa_ (1sso A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.1: "Histone-like" proteins from archaea [54161] (2 proteins)

6. Protein DNA-binding protein [54162] (2 species)

7. Species Sulfolobus solfataricus, Sso7d [TaxId:2287] [54163] (7 PDB entries)
   Uniprot P61991

8. Domain d1ssoa_: 1sso A: [37463]

Details for d1ssoa_

PDB Entry: 1sso

PDB Description: solution structure and dna-binding properties of a thermostable protein from the archaeon sulfolobus solfataricus

PDB Compounds: (A:) sso7d

SCOPe Domain Sequences for d1ssoa_:

Sequence; same for both SEQRES and ATOM records:

>d1ssoa_ b.34.13.1 (A:) DNA-binding protein {Sulfolobus solfataricus, Sso7d [TaxId: 2287]}
atvkfkykgeekqvdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmlek
qk

Timeline for d1ssoa_:

• d1ssoa_ first appeared (with stable ids) in SCOP 1.55, called d1sso__
  
• d1ssoa_ appears in SCOPe 2.04
  
• d1ssoa_ appears in SCOPe 2.06
  
• d1ssoa_ appears in the current release, SCOPe 2.08