Lineage for d1sso__ (1sso -)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 557280Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 557987Superfamily b.34.13: Chromo domain-like [54160] (3 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 557988Family b.34.13.1: "Histone-like" proteins from archaea [54161] (1 protein)
  6. 557989Protein DNA-binding protein [54162] (2 species)
  7. 557999Species Archaeon Sulfolobus solfataricus, Sso7d [TaxId:2287] [54163] (7 PDB entries)
  8. 558005Domain d1sso__: 1sso - [37463]

Details for d1sso__

PDB Entry: 1sso (more details)

PDB Description: solution structure and dna-binding properties of a thermostable protein from the archaeon sulfolobus solfataricus

SCOP Domain Sequences for d1sso__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sso__ b.34.13.1 (-) DNA-binding protein {Archaeon Sulfolobus solfataricus, Sso7d}
atvkfkykgeekqvdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmlek
qk

SCOP Domain Coordinates for d1sso__:

Click to download the PDB-style file with coordinates for d1sso__.
(The format of our PDB-style files is described here.)

Timeline for d1sso__: