Lineage for d1ssoa_ (1sso A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2785033Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2785034Family b.34.13.1: Histone-like proteins from archaea [54161] (2 proteins)
  6. 2785035Protein DNA-binding protein [54162] (2 species)
  7. 2785045Species Sulfolobus solfataricus, Sso7d [TaxId:2287] [54163] (8 PDB entries)
    Uniprot P61991
  8. 2785052Domain d1ssoa_: 1sso A: [37463]

Details for d1ssoa_

PDB Entry: 1sso (more details)

PDB Description: solution structure and dna-binding properties of a thermostable protein from the archaeon sulfolobus solfataricus
PDB Compounds: (A:) sso7d

SCOPe Domain Sequences for d1ssoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ssoa_ b.34.13.1 (A:) DNA-binding protein {Sulfolobus solfataricus, Sso7d [TaxId: 2287]}
atvkfkykgeekqvdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmlek
qk

SCOPe Domain Coordinates for d1ssoa_:

Click to download the PDB-style file with coordinates for d1ssoa_.
(The format of our PDB-style files is described here.)

Timeline for d1ssoa_: