Lineage for d6hkya_ (6hky A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.9: Motor proteins [52641] (5 proteins)
  6. Protein Kinesin [52646] (7 species)
  7. Species Human (Homo sapiens), mitotic kinesin eg5 [TaxId:9606] [64018] (15 PDB entries)
  8. Domain d6hkya_: 6hky A: [374627]
    automated match to d1ii6a_
    complexed with adp, gce, mg

Details for d6hkya_

PDB Entry: 6hky (more details), 2.75 Å

PDB Description: eg5-inhibitor complex
PDB Compounds: (A:) Kinesin-like protein KIF11

SCOPe Domain Sequences for d6hkya_:

Sequence, based on SEQRES records: (download)

>d6hkya_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]}
gkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgas
tkqidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagi
iprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgvi
ikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeel
vkigklnlvdlagsenigrsgavdkrareagninqslltlgrvitalvertphvpyresk
ltrilqdslggrtrtsiiatispaslnleetlstleyahraknilnkpe

Sequence, based on observed residues (ATOM records): (download)

>d6hkya_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]}
gkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgas
tkqidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagi
iprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgvi
ikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkeelvkigkl
nlvdlagsenninqslltlgrvitalvertphvpyreskltrilqdslggrtrtsiiati
spaslnleetlstleyahraknilnkpe

SCOPe Domain Coordinates for d6hkya_ are not available.

Timeline for d6hkya_:

Domains from other chains:
(mouse over for more information)
d6hkyb_, d6hkyc_