Lineage for d1jica_ (1jic A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 797173Superfamily b.34.13: Chromo domain-like [54160] (3 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 797174Family b.34.13.1: "Histone-like" proteins from archaea [54161] (1 protein)
  6. 797175Protein DNA-binding protein [54162] (2 species)
  7. 797187Species Archaeon Sulfolobus solfataricus, Sso7d [TaxId:2287] [54163] (8 PDB entries)
    Uniprot P61991
  8. 797192Domain d1jica_: 1jic A: [37462]

Details for d1jica_

PDB Entry: 1jic (more details)

PDB Description: solution nmr structure of recombinant sso7d with rnase activity, minimized average structure
PDB Compounds: (A:) sso7d

SCOP Domain Sequences for d1jica_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jica_ b.34.13.1 (A:) DNA-binding protein {Archaeon Sulfolobus solfataricus, Sso7d [TaxId: 2287]}
atvkfkykgeekqvdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmlek
qk

SCOP Domain Coordinates for d1jica_:

Click to download the PDB-style file with coordinates for d1jica_.
(The format of our PDB-style files is described here.)

Timeline for d1jica_: