Lineage for d1jic__ (1jic -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30036Fold d.9: IL8-like [54116] (2 superfamilies)
  4. Superfamily d.9.2: Chromo domain-like [54160] (2 families) (S)
  5. Family d.9.2.1: "Histone-like" proteins from arhaea [54161] (1 protein)
  6. Protein DNA-binding protein [54162] (2 species)
  7. Species Sulfolobus solfataricus, Sso7d [TaxId:2287] [54163] (5 PDB entries)
  8. 30197Domain d1jic__: 1jic - [37462]

Details for d1jic__

PDB Entry: 1jic (more details)

PDB Description: solution nmr structure of recombinant sso7d with rnase activity, minimized average structure

SCOP Domain Sequences for d1jic__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jic__ d.9.2.1 (-) DNA-binding protein {Sulfolobus solfataricus, Sso7d}
atvkfkykgeekqvdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmlek
qk

SCOP Domain Coordinates for d1jic__:

Click to download the PDB-style file with coordinates for d1jic__.
(The format of our PDB-style files is described here.)

Timeline for d1jic__: