Lineage for d1bf4a_ (1bf4 A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77416Fold d.9: IL8-like [54116] (2 superfamilies)
  4. 77570Superfamily d.9.2: Chromo domain-like [54160] (2 families) (S)
  5. 77571Family d.9.2.1: "Histone-like" proteins from archaea [54161] (1 protein)
  6. 77572Protein DNA-binding protein [54162] (2 species)
  7. 77580Species Archaeon Sulfolobus solfataricus, Sso7d [TaxId:2287] [54163] (6 PDB entries)
  8. 77581Domain d1bf4a_: 1bf4 A: [37461]

Details for d1bf4a_

PDB Entry: 1bf4 (more details), 1.6 Å

PDB Description: chromosomal dna-binding protein sso7d/d(gcgaacgc) complex

SCOP Domain Sequences for d1bf4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bf4a_ d.9.2.1 (A:) DNA-binding protein {Archaeon Sulfolobus solfataricus, Sso7d}
atvkfkykgeekevdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmlek
qkk

SCOP Domain Coordinates for d1bf4a_:

Click to download the PDB-style file with coordinates for d1bf4a_.
(The format of our PDB-style files is described here.)

Timeline for d1bf4a_: