SCOPe 2.08: Domain d6jgvb_: 6jgv B:

Lineage for d6jgvb_ (6jgv B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
   core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different

4. Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families)

5. Family a.6.1.0: automated matches [191604] (1 protein)
   not a true family

6. Protein automated matches [191102] (6 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:303] [374605] (2 PDB entries)

8. Domain d6jgvb_: 6jgv B: [374609]
   automated match to d5crlb_

Details for d6jgvb_

PDB Entry: 6jgv, 2.2 Å

PDB Description: crystal structure of the transcriptional regulator cadr from p. putida

PDB Compounds: (B:) CadR

SCOPe Domain Sequences for d6jgvb_:

Sequence, based on SEQRES records:

>d6jgvb_ a.6.1.0 (B:) automated matches {Pseudomonas putida [TaxId: 303]}
mkigelakatdcavetiryyereqllpeparsdgnyrlytqahverltfirncrtldmtl
deirsllrlrdspddscgsvnalidehiehvqaridglvalqeqlvelrrrcnaqgaeca
ilqqletn

Sequence, based on observed residues (ATOM records):

>d6jgvb_ a.6.1.0 (B:) automated matches {Pseudomonas putida [TaxId: 303]}
mkigelakatdcavetiryyereqllpeplytqahverltfirncrtldmtldeirsllr
lrdspddsgsvnalidehiehvqaridglvalqeqlvelrrrcnaqgaecailqqletn

Timeline for d6jgvb_:

• d6jgvb_ first appeared in SCOPe 2.07