![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.6: Putative DNA-binding domain [46954] (1 superfamily) core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different |
![]() | Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) ![]() |
![]() | Family a.6.1.0: automated matches [191604] (1 protein) not a true family |
![]() | Protein automated matches [191102] (6 species) not a true protein |
![]() | Species Pseudomonas putida [TaxId:303] [374605] (2 PDB entries) |
![]() | Domain d6jgva_: 6jgv A: [374606] automated match to d5crlb_ |
PDB Entry: 6jgv (more details), 2.2 Å
SCOPe Domain Sequences for d6jgva_:
Sequence, based on SEQRES records: (download)
>d6jgva_ a.6.1.0 (A:) automated matches {Pseudomonas putida [TaxId: 303]} mkigelakatdcavetiryyereqllpeparsdgnyrlytqahverltfirncrtldmtl deirsllrlrdspddscgsvnalidehiehvqaridglvalqeqlvelrrrcnaqgaeca ilqqletn
>d6jgva_ a.6.1.0 (A:) automated matches {Pseudomonas putida [TaxId: 303]} mkigelakatdcavetiryyereqllpeplytqahverltfirncrtldmtldeirsllr lrdspddsgsvnalidehiehvqaridglvalqeqlvelrrrcnaqgaecailqqletn
Timeline for d6jgva_: