Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) the constituent families form similar dimers |
Family c.77.1.0: automated matches [191423] (1 protein) not a true family |
Protein automated matches [190603] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [329721] (11 PDB entries) |
Domain d6kdyg_: 6kdy G: [374597] Other proteins in same PDB: d6kdyb2, d6kdyd2, d6kdyf2, d6kdyh2 automated match to d3blxc_ complexed with 2pe, nad, p6g, pe7, pg4 |
PDB Entry: 6kdy (more details), 3.02 Å
SCOPe Domain Sequences for d6kdyg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6kdyg_ c.77.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gvqtvtlipgdgigpeisaavmkifdaakapiqweernvtaiqgpggkwmipseakesmd knkmglkgplktpiaaghpsmnlllrktfdlyanvrpcvsiegyktpytdvnivtirent egeysgiehvivdgvvqsiklitegaskriaefafeyarnnhrsnvtavhkanimrmsdg lflqkcrevaesckdikfnemyldtvclnmvqdpsqfdvlvmpnlygdilsdlcagligg lgvtpsgnigangvaifesvhgtapdiagkdmanptalllsavmmlrhmglfdhaariea acfatikdgksltkdlggnakcsdfteeicrrvkd
Timeline for d6kdyg_: