Lineage for d6hkxa_ (6hkx A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2449392Family c.37.1.9: Motor proteins [52641] (5 proteins)
  6. 2449393Protein Kinesin [52646] (7 species)
  7. 2449400Species Human (Homo sapiens), mitotic kinesin eg5 [TaxId:9606] [64018] (15 PDB entries)
  8. 3074533Domain d6hkxa_: 6hkx A: [374595]
    automated match to d1ii6a_
    complexed with adp, gce, mg, peg

Details for d6hkxa_

PDB Entry: 6hkx (more details), 2.8 Å

PDB Description: eg5-inhibitor complex
PDB Compounds: (A:) Kinesin-like protein KIF11

SCOPe Domain Sequences for d6hkxa_:

Sequence, based on SEQRES records: (download)

>d6hkxa_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]}
kniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgast
kqidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagii
prtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgvii
kgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelv
kigklnlvdlagsenigrsgavdkrareagninqslltlgrvitalvertphvpyreskl
trilqdslggrtrtsiiatispaslnleetlstleyahraknilnkpe

Sequence, based on observed residues (ATOM records): (download)

>d6hkxa_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]}
kniqvvvrcrpfnhsivecdpvrkevsvrtggladkssrktytfdmvfgastkqidvyrs
vvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiiprtlhqif
ekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviikgleeitv
hnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettlvkigklnlvdlags
enninqslltlgrvitalvertphvpyreskltrilqdslggrtrtsiiatispaslnle
etlstleyahraknilnkpe

SCOPe Domain Coordinates for d6hkxa_:

Click to download the PDB-style file with coordinates for d6hkxa_.
(The format of our PDB-style files is described here.)

Timeline for d6hkxa_:

  • d6hkxa_ is new in SCOPe 2.07-stable