Lineage for d1qnkb_ (1qnk B:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 188772Fold d.9: IL8-like [54116] (2 superfamilies)
  4. 188773Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
  5. 188774Family d.9.1.1: Interleukin 8-like chemokines [54118] (22 proteins)
  6. 188803Protein Gro beta [54156] (1 species)
  7. 188804Species Human (Homo sapiens) [TaxId:9606] [54157] (1 PDB entry)
  8. 188806Domain d1qnkb_: 1qnk B: [37459]

Details for d1qnkb_

PDB Entry: 1qnk (more details)

PDB Description: truncated human grob[5-73], nmr, 20 structures

SCOP Domain Sequences for d1qnkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qnkb_ d.9.1.1 (B:) Gro beta {Human (Homo sapiens)}
telrcqclqtlqgihlkniqsvkvkspgphcaqteviatlkngqkaclnpaspmvkkiie
kmlkngksn

SCOP Domain Coordinates for d1qnkb_:

Click to download the PDB-style file with coordinates for d1qnkb_.
(The format of our PDB-style files is described here.)

Timeline for d1qnkb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qnka_