Lineage for d2hcc__ (2hcc -)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.9: IL8-like [54116] (2 superfamilies) Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) 
Family d.9.1.1: Interleukin 8-like chemokines [54118] (20 proteins) 
Protein Chemokine hcc-2 (macrophage inflammatory protein-5) [54154] (1 species) Species Human (Homo sapiens) [TaxId:9606] [54155] (1 PDB entry) 
Domain d2hcc__: 2hcc - [37457]
Details for d2hcc__
PDB Entry: 2hcc (more details)
PDB Description: solution structure of the human chemokine hcc-2, nmr, 30 structures
SCOP Domain Sequences for d2hcc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hcc__ d.9.1.1 (-) Chemokine hcc-2 (macrophage inflammatory protein-5) {Human (Homo sapiens)}
hfaadcctsyisqsipcslmksyfetssecskpgvifltkkgrqvcakpsgpgvqdcmkk
lkpysi
SCOP Domain Coordinates for d2hcc__:
Click to download the PDB-style file with coordinates for d2hcc__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2hcc__:
- d2hcc__ first appeared (with stable ids) in SCOP 1.55
- d2hcc__ appears in SCOP 1.59
- d2hcc__ appears in the current release, SCOPe 2.08, called d2hcca_
View in 3D