Lineage for d2hcc__ (2hcc -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30036Fold d.9: IL8-like [54116] (2 superfamilies)
  4. 30037Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
  5. 30038Family d.9.1.1: Interleukin 8-like chemokines [54118] (19 proteins)
  6. 30049Protein Chemokine hcc-2 (macrophage inflammatory protein-5) [54154] (1 species)
  7. 30050Species Human (Homo sapiens) [TaxId:9606] [54155] (1 PDB entry)
  8. 30051Domain d2hcc__: 2hcc - [37457]

Details for d2hcc__

PDB Entry: 2hcc (more details)

PDB Description: solution structure of the human chemokine hcc-2, nmr, 30 structures

SCOP Domain Sequences for d2hcc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hcc__ d.9.1.1 (-) Chemokine hcc-2 (macrophage inflammatory protein-5) {Human (Homo sapiens)}
hfaadcctsyisqsipcslmksyfetssecskpgvifltkkgrqvcakpsgpgvqdcmkk
lkpysi

SCOP Domain Coordinates for d2hcc__:

Click to download the PDB-style file with coordinates for d2hcc__.
(The format of our PDB-style files is described here.)

Timeline for d2hcc__: