Lineage for d2hcca_ (2hcc A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928974Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2928975Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2928976Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2928987Protein Chemokine hcc-2 (macrophage inflammatory protein-5) [54154] (1 species)
  7. 2928988Species Human (Homo sapiens) [TaxId:9606] [54155] (1 PDB entry)
  8. 2928989Domain d2hcca_: 2hcc A: [37457]

Details for d2hcca_

PDB Entry: 2hcc (more details)

PDB Description: solution structure of the human chemokine hcc-2, nmr, 30 structures
PDB Compounds: (A:) human chemokine hcc-2

SCOPe Domain Sequences for d2hcca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hcca_ d.9.1.1 (A:) Chemokine hcc-2 (macrophage inflammatory protein-5) {Human (Homo sapiens) [TaxId: 9606]}
hfaadcctsyisqsipcslmksyfetssecskpgvifltkkgrqvcakpsgpgvqdcmkk
lkpysi

SCOPe Domain Coordinates for d2hcca_:

Click to download the PDB-style file with coordinates for d2hcca_.
(The format of our PDB-style files is described here.)

Timeline for d2hcca_: