Lineage for d6rska1 (6rsk A:-4-103)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303644Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2303645Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2303646Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2303863Protein Mitochondrial cytochrome c [46642] (7 species)
  7. 2303867Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (88 PDB entries)
    Uniprot P00044
  8. 3074488Domain d6rska1: 6rsk A:-4-103 [374550]
    Other proteins in same PDB: d6rska2, d6rskb2
    automated match to d5t8wa_
    complexed with evb, hec, so4, spm

Details for d6rska1

PDB Entry: 6rsk (more details), 2.31 Å

PDB Description: cytochrome c co-crystallized with 20 eq. sulfonato-calix[8]arene and 15 eq. spermine - structure ii
PDB Compounds: (A:) Cytochrome c iso-1

SCOPe Domain Sequences for d6rska1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rska1 a.3.1.1 (A:-4-103) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
efkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikkn
vlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate

SCOPe Domain Coordinates for d6rska1:

Click to download the PDB-style file with coordinates for d6rska1.
(The format of our PDB-style files is described here.)

Timeline for d6rska1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6rska2