![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.9: IL8-like [54116] (1 superfamily) beta(3)-alpha |
![]() | Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) ![]() form dimers with different dimerisation modes |
![]() | Family d.9.1.1: Interleukin 8-like chemokines [54118] (24 proteins) |
![]() | Protein Stromal cell-derived factor-1 (SDF-1) [54150] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54151] (4 PDB entries) |
![]() | Domain d2sdf__: 2sdf - [37454] |
PDB Entry: 2sdf (more details)
SCOP Domain Sequences for d2sdf__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2sdf__ d.9.1.1 (-) Stromal cell-derived factor-1 (SDF-1) {Human (Homo sapiens)} kpvslsyrcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqe ylekaln
Timeline for d2sdf__: