Lineage for d2sdf__ (2sdf -)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 597802Fold d.9: IL8-like [54116] (1 superfamily)
    beta(3)-alpha
  4. 597803Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
    form dimers with different dimerisation modes
  5. 597804Family d.9.1.1: Interleukin 8-like chemokines [54118] (24 proteins)
  6. 597996Protein Stromal cell-derived factor-1 (SDF-1) [54150] (1 species)
  7. 597997Species Human (Homo sapiens) [TaxId:9606] [54151] (4 PDB entries)
  8. 598002Domain d2sdf__: 2sdf - [37454]

Details for d2sdf__

PDB Entry: 2sdf (more details)

PDB Description: solution nmr structure of stromal cell-derived factor-1 (sdf-1), 30 structures

SCOP Domain Sequences for d2sdf__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2sdf__ d.9.1.1 (-) Stromal cell-derived factor-1 (SDF-1) {Human (Homo sapiens)}
kpvslsyrcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqe
ylekaln

SCOP Domain Coordinates for d2sdf__:

Click to download the PDB-style file with coordinates for d2sdf__.
(The format of our PDB-style files is described here.)

Timeline for d2sdf__: