SCOP 1.67: Domain d2sdf__: 2sdf -

Lineage for d2sdf__ (2sdf -)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.9: IL8-like [54116] (1 superfamily)
   beta(3)-alpha

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family)
   form dimers with different dimerisation modes

5. Family d.9.1.1: Interleukin 8-like chemokines [54118] (24 proteins)

6. Protein Stromal cell-derived factor-1 (SDF-1) [54150] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54151] (4 PDB entries)

8. Domain d2sdf__: 2sdf - [37454]

Details for d2sdf__

PDB Entry: 2sdf

PDB Description: solution nmr structure of stromal cell-derived factor-1 (sdf-1), 30 structures

SCOP Domain Sequences for d2sdf__:

Sequence; same for both SEQRES and ATOM records:

>d2sdf__ d.9.1.1 (-) Stromal cell-derived factor-1 (SDF-1) {Human (Homo sapiens)}
kpvslsyrcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqe
ylekaln

Timeline for d2sdf__:

• d2sdf__ first appeared (with stable ids) in SCOP 1.55
  
• d2sdf__ appears in SCOP 1.65
  
• d2sdf__ appears in SCOP 1.69
  
• d2sdf__ appears in the current release, SCOPe 2.08, called d2sdfa_