Lineage for d2sdf__ (2sdf -)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.9: IL8-like [54116] (2 superfamilies) Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) 
Family d.9.1.1: Interleukin 8-like chemokines [54118] (20 proteins) 
Protein Stromal cell-derived factor-1 (SDF-1) [54150] (1 species) Species Human (Homo sapiens) [TaxId:9606] [54151] (4 PDB entries) 
Domain d2sdf__: 2sdf - [37454]
Details for d2sdf__
PDB Entry: 2sdf (more details)
PDB Description: solution nmr structure of stromal cell-derived factor-1 (sdf-1), 30 structures
SCOP Domain Sequences for d2sdf__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2sdf__ d.9.1.1 (-) Stromal cell-derived factor-1 (SDF-1) {Human (Homo sapiens)}
kpvslsyrcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqe
ylekaln
SCOP Domain Coordinates for d2sdf__:
Click to download the PDB-style file with coordinates for d2sdf__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2sdf__:
- d2sdf__ first appeared (with stable ids) in SCOP 1.55
- d2sdf__ appears in SCOP 1.59
- d2sdf__ appears in the current release, SCOPe 2.08, called d2sdfa_
View in 3D