Lineage for d1sdf__ (1sdf -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30036Fold d.9: IL8-like [54116] (2 superfamilies)
  4. 30037Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
  5. 30038Family d.9.1.1: Interleukin 8-like chemokines [54118] (19 proteins)
  6. 30177Protein Stromal cell-derived factor-1 (SDF-1) [54150] (1 species)
  7. 30178Species Human (Homo sapiens) [TaxId:9606] [54151] (4 PDB entries)
  8. 30183Domain d1sdf__: 1sdf - [37453]

Details for d1sdf__

PDB Entry: 1sdf (more details)

PDB Description: solution structure of stromal cell-derived factor-1 (sdf-1), nmr, minimized average structure

SCOP Domain Sequences for d1sdf__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sdf__ d.9.1.1 (-) Stromal cell-derived factor-1 (SDF-1) {Human (Homo sapiens)}
kpvslsyrcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqe
ylekaln

SCOP Domain Coordinates for d1sdf__:

Click to download the PDB-style file with coordinates for d1sdf__.
(The format of our PDB-style files is described here.)

Timeline for d1sdf__: