SCOPe 2.08: Domain d1sdfa_: 1sdf A:

Lineage for d1sdfa_ (1sdf A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.9: IL8-like [54116] (2 superfamilies)
   beta(3)-alpha

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families)
   form dimers with different dimerisation modes

5. Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)

6. Protein Stromal cell-derived factor-1 (SDF-1) [54150] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54151] (21 PDB entries)

8. Domain d1sdfa_: 1sdf A: [37453]

Details for d1sdfa_

PDB Entry: 1sdf

PDB Description: solution structure of stromal cell-derived factor-1 (sdf-1), nmr, minimized average structure

PDB Compounds: (A:) stromal cell-derived factor-1

SCOPe Domain Sequences for d1sdfa_:

Sequence; same for both SEQRES and ATOM records:

>d1sdfa_ d.9.1.1 (A:) Stromal cell-derived factor-1 (SDF-1) {Human (Homo sapiens) [TaxId: 9606]}
kpvslsyrcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqe
ylekaln

Timeline for d1sdfa_:

• d1sdfa_ first appeared (with stable ids) in SCOP 1.55, called d1sdf__
  
• d1sdfa_ appears in SCOPe 2.07